PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00001.413
Common NameAMTR_s00001p00267050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 26015.5 Da    PI: 9.8139
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00001.413genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.65.3e-31958150
                                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                              krienk+nrqvtfskRrng+lKKA+ELSvLCdaev +iifss+gklye+ 
  evm_27.model.AmTr_v1.0_scaffold00001.413  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVGLIIFSSRGKLYEFG 58
                                              79**********************************************95 PP

2K-box107.12e-3577171599
                                     K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnell 73 
                                               +++s++++++++++qel+kLk+++e+Lqr+qRhllGedL++Ls+keLqqLe+qLe +l++ R++K+++l
  evm_27.model.AmTr_v1.0_scaffold00001.413  77 QDNSATDRETQNWSQELSKLKAKYETLQRSQRHLLGEDLGPLSVKELQQLERQLEVALSQARQRKTQIL 145
                                               66778999************************************************************* PP

                                     K-box  74 leqieelqkkekelqeenkaLrkkle 99 
                                               ++q+eel++ke++l ++nk+L++kle
  evm_27.model.AmTr_v1.0_scaffold00001.413 146 MDQMEELRRKERRLGDINKQLKSKLE 171
                                               ***********************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.235161IPR002100Transcription factor, MADS-box
CDDcd002651.31E-43272No hitNo description
SuperFamilySSF554551.83E-34291IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-32323IPR002100Transcription factor, MADS-box
PfamPF003197.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-323859IPR002100Transcription factor, MADS-box
PfamPF014868.8E-3182170IPR002487Transcription factor, K-box
PROSITE profilePS5129717.29386176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0009911Biological Processpositive regulation of flower development
GO:0010094Biological Processspecification of carpel identity
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVGLIIFSS RGKLYEFGSA  60
GLSKTLERYQ RCCYTPQDNS ATDRETQNWS QELSKLKAKY ETLQRSQRHL LGEDLGPLSV  120
KELQQLERQL EVALSQARQR KTQILMDQME ELRRKERRLG DINKQLKSKL ESDGQGSFRG  180
IQGTWESGTV VGNNAFAVNP SHANPIDCEP TLQIGTGPAE SNFVQGWVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A9e-229117422104Developmental protein SEPALLATA 3
4ox0_B9e-229117422104Developmental protein SEPALLATA 3
4ox0_C9e-229117422104Developmental protein SEPALLATA 3
4ox0_D9e-229117422104Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9362340.0AY936234.1 Amborella trichopoda AGL6 (AGL6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001292762.11e-165MADS-box transcription factor 6
SwissprotQ6EU391e-117MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLW1NLY81e-169W1NLY8_AMBTC; Uncharacterized protein
STRINGVIT_15s0048g01270.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.11e-103AGAMOUS-like 6
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]